PTM Viewer PTM Viewer

AT5G42380.1

Arabidopsis thaliana [ath]

calmodulin like 37

No PTMs currently found

PLAZA: AT5G42380
Gene Family: HOM05D000135
Other Names: AtCML37; CML37

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 185

MTLAKNQKSSLSRLYKKVSSKRSESSRNLEDESRTSSNSSGSSSLNVNELRTVFDYMDANSDGKISGEELQSCVSLLGGALSSREVEEVVKTSDVDGDGFIDFEEFLKLMEGEDGSDEERRKELKEAFGMYVMEGEEFITAASLRRTLSRLGESCTVDACKVMIRGFDQNDDGVLSFDEFVLMMR

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR002048 45 116
139 185
Sites
Show Type Position
Active Site 58
Active Site 60
Active Site 62
Active Site 64
Active Site 69
Active Site 94
Active Site 96
Active Site 98
Active Site 105
Active Site 168
Active Site 170
Active Site 172
Active Site 179

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here